NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074473_10465785

Scaffold Ga0074473_10465785


Overview

Basic Information
Taxon OID3300005830 Open in IMG/M
Scaffold IDGa0074473_10465785 Open in IMG/M
Source Dataset NameMicrobial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon Health and Science University (OHSU)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)515
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location NameAstoria, Oregon, USA
CoordinatesLat. (o)46.17784Long. (o)-123.85335Alt. (m)Depth (m).02
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026912Metagenome196Y

Sequences

Protein IDFamilyRBSSequence
Ga0074473_104657851F026912N/ATMGKKERKPIFSIIDSMIDDSEPLRAEYLRGYHRGIEVQVFGVSDEWIEEHRMLTDYSIGGSGDSYIDMYARGYSHGLEGRTPECPSLSSGSFLIA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.