Basic Information | |
---|---|
Taxon OID | 3300005796 Open in IMG/M |
Scaffold ID | Ga0079492_100331 Open in IMG/M |
Source Dataset Name | Subglacial sediment microbial community from Lake Whillans, Antarctica - at 14-16 cm depth |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6078 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (62.50%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | West Antarctica | |||||||
Coordinates | Lat. (o) | -84.24 | Long. (o) | -153.694 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041287 | Metagenome / Metatranscriptome | 160 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0079492_1003317 | F041287 | AGGAGG | MEVCFKCRNQADFICPDCGTKVCIAHAELRYSGPHRGLKSRYMCPICWKMKRVVLNESMLNAREYKPKLYVFSSRKIGI* |
⦗Top⦘ |