Basic Information | |
---|---|
Taxon OID | 3300005758 Open in IMG/M |
Scaffold ID | Ga0078117_1047898 Open in IMG/M |
Source Dataset Name | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3669 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Cyanobacterial Bloom Metagenomics Project |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.411221 | Long. (o) | 103.905587 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069784 | Metagenome | 123 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0078117_10478984 | F069784 | GGA | MSKTANRQPLTVRLDPESKRLFSEEAEKCGLEAGVAARQILELYVQRLRESGDYIQTLADFSAALKTRAA* |
⦗Top⦘ |