NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078894_10535924

Scaffold Ga0078894_10535924


Overview

Basic Information
Taxon OID3300005662 Open in IMG/M
Scaffold IDGa0078894_10535924 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1048
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001460Metagenome / Metatranscriptome690Y
F007644Metagenome / Metatranscriptome347Y
F025737Metagenome / Metatranscriptome200Y

Sequences

Protein IDFamilyRBSSequence
Ga0078894_105359241F025737GGAGLKPEDKDKLNKCLEILDSTDLGLSLVWLWTWSTINNILEDDTYVAKATQEDMWNHLCEA
Ga0078894_105359243F007644AGGAGMLTRSSHFLEYMKLHLISLEQDLEENPCSFHVVDIEGQIYATKHLLSVATDIMNSSNERYE*
Ga0078894_105359245F001460GGAGGMLGYTKDDLDEMINSVHDAKLFYLRTPSDLMDKSILTEGLLKTNDFLQGLWAEGYFDNAN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.