NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066692_10023327

Scaffold Ga0066692_10023327


Overview

Basic Information
Taxon OID3300005555 Open in IMG/M
Scaffold IDGa0066692_10023327 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3177
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000217Metagenome / Metatranscriptome1557Y
F000440Metagenome / Metatranscriptome1137Y
F001138Metagenome / Metatranscriptome767Y

Sequences

Protein IDFamilyRBSSequence
Ga0066692_100233272F000217AGGAGMSAKILTFSSDGDKTLLEYDPATVDMEEVNNMIAEYEAQTGAQPFDMATGERLEKVTREQNEVLMVHPIAGG*
Ga0066692_100233273F001138N/AMIGFIALMVWRFVFAGPHRWPLVRATAPRQHRRNNVLEEGLHISDPGGVAVVAGNRFENSSDDLDALDPKDRAKRYLRRIVALTGATQMGNSYVLDVGKMRFQVGHRYVRRMRDMTDPRCAYEETCFYSAHEGMPKAEETATALLHLTNKPALFDKWAVQNGLAFKADGQVFSRTQ*
Ga0066692_100233274F000440N/AMRTRTKCAPGQRAAEYLNRIAALTGAKQVCGECYRLTVGGMHFLVDSKFVHVINPRSESTCFSVAADPDMPSAEVLASALLQLKNNARLFEKWREWPAYTFKANGKMFRDKYQLTRDET*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.