NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066686_10095390

Scaffold Ga0066686_10095390


Overview

Basic Information
Taxon OID3300005446 Open in IMG/M
Scaffold IDGa0066686_10095390 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1907
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004117Metagenome / Metatranscriptome452Y
F004347Metagenome / Metatranscriptome442Y

Sequences

Protein IDFamilyRBSSequence
Ga0066686_100953901F004117AGGCGGMALRKRIGSRPRARRPPTEPLVPLTTTCRISRVAGAFLLVGLLTSPGGSASDPGAAPDDRGPAPASAALAASVSETPDAVRLRIQASGDVEPGSVEVRFAGRKAVVLARDAEGRAIRSQPLRLPEPVVEEGSSADYYADGALVVTLRKQATAQDAGPTGDPEAVPR*
Ga0066686_100953902F004347AGGAGVQAETASWLNKSRGSFGAAQSRFNDISSMDVTGAGALFMSAEYAMKAVIVEHYGFLPSSFKTHHRIVNLSHLIGLWWQLPPDLRAYLADIAPLDPNVLYPRETRPRDPPRTYETLVSSSSNAEWQQRLTTAPRFIQYIERDVIGNPAAFGKLTF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.