NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074258_116378

Scaffold Ga0074258_116378


Overview

Basic Information
Taxon OID3300005443 Open in IMG/M
Scaffold IDGa0074258_116378 Open in IMG/M
Source Dataset NameWastewater bioreactor microbial communities from Singapore -TA reactor DNA contigs from 4 sample
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)808
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Terephthalate → Wastewater → Bioreactor → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Singapore And Univ Of Illinois At Urbana, That Are Terephthalate-Degrading

Source Dataset Sampling Location
Location NameNational University of Singapore, Singapore
CoordinatesLat. (o)1.332Long. (o)103.756Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029922Metagenome / Metatranscriptome187Y

Sequences

Protein IDFamilyRBSSequence
Ga0074258_1163781F029922N/AMEKRQMDLLPMLSREELYGFGIIDISEMIMSIEHAINYAEGYRFLLLCFGNEGSSDKAKMIMKGLEDYLQIVKDVYRFKVDEKKKRENFLKGVNA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.