Basic Information | |
---|---|
Taxon OID | 3300005371 Open in IMG/M |
Scaffold ID | Ga0074245_190 Open in IMG/M |
Source Dataset Name | Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Summer Sample 10335 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 28885 |
Total Scaffold Genes | 27 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 16 (59.26%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Late winter and summer Antarctic waters | |||||||
Coordinates | Lat. (o) | -64.067 | Long. (o) | -64.767 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F033598 | Metagenome / Metatranscriptome | 177 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074245_19018 | F033598 | AGTAG | LAPLDIASRLRAPLPAKGSIIVLSAISNCSQLKRVSLILPGEGRSPSASGKLNFLPLRFPAIILKVLSLIRLK* |
⦗Top⦘ |