| Basic Information | |
|---|---|
| Taxon OID | 3300005351 Open in IMG/M |
| Scaffold ID | Ga0074239_106414 Open in IMG/M |
| Source Dataset Name | Bioreactor Anammox bacterial community from Nijmegen, The Netherlands - Scalindua species enirchment |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 11117 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (30.77%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Nitrogen Removal → Anammox → Bioreactor → Bioreactor Anammox Bacterial Community From Nijmegen, The Netherlands |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Nijmegen, The Netherlands | |||||||
| Coordinates | Lat. (o) | 51.842 | Long. (o) | 5.858 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F078263 | Metagenome / Metatranscriptome | 116 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074239_1064146 | F078263 | AGGAGG | MELLHDSEELVGSLDCQLKRLEEKIDTSQSVELMKDLHRMDDEIRHFKDVEITTNSVVSSVNKQGETIKKIEEGTRNKFTEMTSQMKSTEAMVADKHKNLISKINGISSRVDSLEEKIDLAVRELKSEARKTSVLRKLLWLD* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |