| Basic Information | |
|---|---|
| Taxon OID | 3300005293 Open in IMG/M |
| Scaffold ID | Ga0065715_10490612 Open in IMG/M |
| Source Dataset Name | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 788 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → unclassified Caulobacter → Caulobacter sp. UNC279MFTsu5.1 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere → Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan State University, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kellogg Biological Station, Michigan State University | |||||||
| Coordinates | Lat. (o) | 42.406189 | Long. (o) | -85.40016 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067980 | Metagenome | 125 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0065715_104906121 | F067980 | AGG | MFALRAISILAGVLLPFLAILPACSLQSRIEDRTDTKAKANEKEKSAKSKPVKPTVWNLDGGVFFATDGHLRNGSCFRLSGQMNAPDFFDGLRRMDSEEGTSYYLRGQLVTEFPGEVQIIIRLLDFPCSLDLKDTLVRPPITRETMATLRLNFYWKQGVHMRPVEDTKRTAAEVRRIGTFAAGPAADDELAPRYEWSYTFTVKSENIPPTNDLVLIITGEDGKIAARVAARL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |