NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074072_1046866

Scaffold Ga0074072_1046866


Overview

Basic Information
Taxon OID3300005260 Open in IMG/M
Scaffold IDGa0074072_1046866 Open in IMG/M
Source Dataset NameMicrobial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAustralian Centre for Ecogenomics
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1297
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Microbial Communities On The Surface Of Biochar

Source Dataset Sampling Location
Location NameSydney
CoordinatesLat. (o)-33.917926Long. (o)151.235347Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016560Metagenome / Metatranscriptome246Y
F031541Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0074072_10468661F031541AGGAGMAKLVPHAEATAASLAQVLRTHRVDEDGLAERPTRAWAARRLLEELGVRCKESSSLLDLKGFLISSRRGTEIVVSDTLSDEEQVSVYAHLVAHALLGPEYPELALAARFEYVPGRAPDARPAQEVQEERVADAVARAILEGRLEAAPRLVYCRDSGPGRGRCSRAVLRGIHSGSLALYWHSRSYQRLRSLPVVTAVTERVHSFLGNAA*
Ga0074072_10468662F016560N/AMTDRDEVQVARWTAIKGRVGTCLREIRQADQHAPRSQARLAGDLEELGYHVTQSMVSRYEQGLLDAPLTLERRVGWALCCESLSSRAFKELLGLAGFYLPWQDAELSAFDELLRSYRRLSLADQVDVRGRLLWHVLGIEEQRPDG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.