Basic Information | |
---|---|
Taxon OID | 3300005043 Open in IMG/M |
Scaffold ID | Ga0071100_1056615 Open in IMG/M |
Source Dataset Name | Mid-Atlantic Ridge North Pond Expedition - Sample 1382A |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | The Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 942 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer → Deep Marine Subsurface Microbial Communities From Mid-Atlantic Ridge (Iodp Expedition 336) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pond, Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 22.78 | Long. (o) | -46.09 | Alt. (m) | Depth (m) | 90 to 210 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011815 | Metagenome / Metatranscriptome | 287 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0071100_10566151 | F011815 | N/A | LEQINKDLSFGISFSQTKRNDHARELCTKVSSAIKDYSSKILQKIEAGPSETLTEQNEHNLAAIIYYDVQVQDAMKRLGVADDGELVLAVNRLKSLQKLYLFEQKGGENYLD* |
⦗Top⦘ |