Basic Information | |
---|---|
Taxon OID | 3300004930 Open in IMG/M |
Scaffold ID | Ga0070794_102360 Open in IMG/M |
Source Dataset Name | Simulated microbial communities from King Abdullah University of Science and Technology - simArt49e |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Heinrich Heine University of Dusseldorf |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 8214 |
Total Scaffold Genes | 16 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 16 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Modeled → Simulated Communities (Dna Mixture) → Unclassified → Unclassified → Simulated → Simulated Microbial Communities From King Abdullah University Of Science And Technology |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010244 | Metagenome / Metatranscriptome | 306 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0070794_1023602 | F010244 | AGAAGG | VKYKVMFTHSDKGQKRGHKLREGKEIYQHPEGYFVVLEFEGESGKFREAFWPEDIVKDKLFL* |
⦗Top⦘ |