NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070794_102360

Scaffold Ga0070794_102360


Overview

Basic Information
Taxon OID3300004930 Open in IMG/M
Scaffold IDGa0070794_102360 Open in IMG/M
Source Dataset NameSimulated microbial communities from King Abdullah University of Science and Technology - simArt49e
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterHeinrich Heine University of Dusseldorf
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8214
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Modeled → Simulated Communities (Dna Mixture) → Unclassified → Unclassified → Simulated → Simulated Microbial Communities From King Abdullah University Of Science And Technology

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010244Metagenome / Metatranscriptome306Y

Sequences

Protein IDFamilyRBSSequence
Ga0070794_1023602F010244AGAAGGVKYKVMFTHSDKGQKRGHKLREGKEIYQHPEGYFVVLEFEGESGKFREAFWPEDIVKDKLFL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.