| Basic Information | |
|---|---|
| Taxon OID | 3300004881 Open in IMG/M |
| Scaffold ID | Ga0068280_100001 Open in IMG/M |
| Source Dataset Name | Ecklonia radiata associated microbial communities from Long Bay, Malabar Australia B3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of New South Wales |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 91824 |
| Total Scaffold Genes | 127 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 31 (24.41%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Ecklonia Radiata Associated → Ecklonia Radiata Associated Microbial Communities From Long Bay, Malabar Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Long Bay, Malabar, NSW 2036 | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056035 | Metagenome / Metatranscriptome | 138 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068280_10000170 | F056035 | N/A | MSLLYKDPKDVKITCHIKQEEGKIILGFTADCGKFGTEETLDHYVLTPKRLIQILQDRDDYTEKEL* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |