Basic Information | |
---|---|
Taxon OID | 3300004881 Open in IMG/M |
Scaffold ID | Ga0068280_100001 Open in IMG/M |
Source Dataset Name | Ecklonia radiata associated microbial communities from Long Bay, Malabar Australia B3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of New South Wales |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 91824 |
Total Scaffold Genes | 127 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 31 (24.41%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Ecklonia Radiata Associated → Ecklonia Radiata Associated Microbial Communities From Long Bay, Malabar Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Long Bay, Malabar, NSW 2036 | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056035 | Metagenome / Metatranscriptome | 138 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0068280_10000170 | F056035 | N/A | MSLLYKDPKDVKITCHIKQEEGKIILGFTADCGKFGTEETLDHYVLTPKRLIQILQDRDDYTEKEL* |
⦗Top⦘ |