Basic Information | |
---|---|
Taxon OID | 3300004383 Open in IMG/M |
Scaffold ID | Ga0064591_10039926 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Bothnian Bay, Baltic Sea |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Gottingen |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 547 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine Sediment → Marine Microbial Communities From Bothnian Bay, Baltic Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bothnian Bay, Baltic Sea | |||||||
Coordinates | Lat. (o) | 65.4530556 | Long. (o) | 23.3088889 | Alt. (m) | Depth (m) | 75 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010462 | Metagenome / Metatranscriptome | 303 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0064591_100399261 | F010462 | N/A | MLYQLPNGKVVHLSIEEYLSLTDLDIQFLMSIDYGEHILDPFTGSAVEKNTREKYIDTDFLPLEDYDLNDIPSDDLPFDDIIDLQDPLDN* |
⦗Top⦘ |