NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063455_100215973

Scaffold Ga0063455_100215973


Overview

Basic Information
Taxon OID3300004153 Open in IMG/M
Scaffold IDGa0063455_100215973 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from Hopland, California, USA (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)966
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Mediterranean Grasslands, California

Source Dataset Sampling Location
Location NameUSA: Hopland, California
CoordinatesLat. (o)38.99297339Long. (o)-123.0674491Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026610Metagenome197Y

Sequences

Protein IDFamilyRBSSequence
Ga0063455_1002159732F026610AGCAGMKYTVVMVPSATRTRVLVSHGSDELLRAILPPPSAIRYQEAALAFLQGLSLWLDEKLHVVLSVDEREAGSCLGLTDEMGLGLHSVYFDVEVHDRRARRRRGQRIRGIGDFADLRQLCLRWLVPDGN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.