Basic Information | |
---|---|
Taxon OID | 3300004093 Open in IMG/M |
Scaffold ID | Ga0065178_106412 Open in IMG/M |
Source Dataset Name | Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-22 (version 2) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1410 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 37.9313884 | Long. (o) | -122.0239394 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066275 | Metagenome | 127 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0065178_1064122 | F066275 | AGGAGG | VNEAHFREIEKVLLYVSEARRKAERVAESIERDGAEPHLVAALRDAERDLAELHRRLMHGTYWAVPKEQLALVPEDGPGR* |
⦗Top⦘ |