| Basic Information | |
|---|---|
| Taxon OID | 3300003973 Open in IMG/M |
| Scaffold ID | Ga0063521_1002681 Open in IMG/M |
| Source Dataset Name | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | HPI Heinrich-Pette-Institut |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4304 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Ips Typographus Gut → Ips Typographus Gut Microbial Communities From Hannover, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hannover, Germany | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005599 | Metagenome / Metatranscriptome | 395 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063521_10026815 | F005599 | N/A | MRVKPEQASKVMMWMPTCLRFGEGRVNGEAIDMGTRSIHPGIGHGTLEG* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |