NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0062456_1008362

Scaffold Ga0062456_1008362


Overview

Basic Information
Taxon OID3300003868 Open in IMG/M
Scaffold IDGa0062456_1008362 Open in IMG/M
Source Dataset NameAlpena Fountain idba assembled
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)964
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Fountain Water → Fountain Water Microbial Communities From Alpena County Library, Michigan, Usa

Source Dataset Sampling Location
Location NameAlpena Town, Michigan
CoordinatesLat. (o)45.062461Long. (o)-83.431242Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050966Metagenome / Metatranscriptome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0062456_10083622F050966GGAGMRENLMSGSRWQGMKTRHGDGTEALSQEMESNGSATPKSRRHPLTLPADVWDSARFTSIF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.