| Basic Information | |
|---|---|
| Taxon OID | 3300003525 Open in IMG/M |
| Scaffold ID | FS900RNA_10011 Open in IMG/M |
| Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS900_Dependable_RNA |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 712 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Axial seamount, northeast pacific ocean | |||||||
| Coordinates | Lat. (o) | 45.87992 | Long. (o) | -129.80294 | Alt. (m) | Depth (m) | 1917 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010914 | Metagenome / Metatranscriptome | 297 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FS900RNA_100112 | F010914 | AGG | MIYNILVEQNGKFVTTGETVECEFEETQAVIDELQAERGCCCALETVSE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |