Basic Information | |
---|---|
Taxon OID | 3300003440 Open in IMG/M |
Scaffold ID | PWMHGC_102060 Open in IMG/M |
Source Dataset Name | Hydrocarbon microbial community from Medicine Hat (2PWMHGC) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1802 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Subsurface Hydrocarbon → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Medicine Hat, Alberta, Canada | |||||||
Coordinates | Lat. (o) | 56.22 | Long. (o) | -117.33 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F055749 | Metagenome / Metatranscriptome | 138 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
PWMHGC_1020605 | F055749 | AGAAG | MNLIIAIAIGILTLIAVFSVIPVVGGSIDNAMPTLGADSEWNTTVNSDLPSGASMWSQLGPLLVLAVLAMVIGLVIMYFRNAAG* |
⦗Top⦘ |