NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25922J50271_10001720

Scaffold JGI25922J50271_10001720


Overview

Basic Information
Taxon OID3300003413 Open in IMG/M
Scaffold IDJGI25922J50271_10001720 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6322
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030758Metagenome / Metatranscriptome184Y
F043932Metagenome / Metatranscriptome155Y
F068831Metagenome / Metatranscriptome124N

Sequences

Protein IDFamilyRBSSequence
JGI25922J50271_100017203F043932AGGMAKKFKSLLNLLTLSEDPVIGSTGDVYFNVVSKNIKIYNGAIWVDLTPGSTDPAPFYMHTHSYDGNVHTVNLQETIDFSEINNNADVLETSPAIIGLDGGTPTSSYANASYTELTLLDGGQIGN*
JGI25922J50271_100017204F068831GGAGGLATSYPTSKDNLTNPAANESMEGHASLHGNVNDAIEAIENKLGVDGSTDVNSIDYKVSQLQANLSTLDAENASELLGLDGNNDLTIDGIENKTIVDSFSKTVYKTVRYTLQIDKSAGNLTHTSTIVLLNDGTNVYISESDIVSNTDLSLATVTFEENNGIISLCVTPVSGSIKVRYFRTALKA*
JGI25922J50271_100017206F030758GGAMATVDKNFKVKNGLNVAGTATFGSNVVLGETPLRFDTSTSKLQIQLNGTWVPIAFNSDIPDTTQDISFMDIGLAIDYNGEPTYIVQANGVTPTGINKFINGGDPSSTDADVSMVFDSGALA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.