NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25910J50241_10011266

Scaffold JGI25910J50241_10011266


Overview

Basic Information
Taxon OID3300003388 Open in IMG/M
Scaffold IDJGI25910J50241_10011266 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3208
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016365Metagenome / Metatranscriptome247Y
F049582Metagenome / Metatranscriptome146Y
F068762Metagenome / Metatranscriptome124N
F082595Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
JGI25910J50241_100112662F082595AGGAGGMSIPMKTFRFMVLIDNKSPGVIVEQRAMNVTQATQAVQAQYGSNCRVTFYGMVNE*
JGI25910J50241_100112664F068762GAGGMLRQQDLYHLYAGIRERLHEIMINERHPDPMQGQVRREMAEELLEYLQGTEQGLKTMTDYKEQWTRGENE*
JGI25910J50241_100112665F016365AGGAMNATQKLILATAAVIYGMTAPLPANETIKETQDALNKWYETVSTSVSQDVTALGVTVVNMPEKISLGVSNFWEETKQFQKDSWNETLKFEQEKQNWENYQRLVYTCNRRG*
JGI25910J50241_100112668F049582AGGAGMAKKDIYQVLEQRYSSESDLTVSMMKRAISELHIVNPKSLDLIYESVIFYTGDWPESEGWGTSDSRICMNSVKETLLACEYLMGVAR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.