NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI25910J50241_10003143

Scaffold JGI25910J50241_10003143


Overview

Basic Information
Taxon OID3300003388 Open in IMG/M
Scaffold IDJGI25910J50241_10003143 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6002
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (43.75%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000671Metagenome / Metatranscriptome945Y
F008814Metagenome / Metatranscriptome327Y
F011394Metagenome / Metatranscriptome291Y
F040629Metagenome / Metatranscriptome161Y

Sequences

Protein IDFamilyRBSSequence
JGI25910J50241_1000314310F000671GGAMEKVLCYCCNKSKAALTLKKSALMPINLLLCETCITTKIEPRWVVILSGRQYGHEYVKDYVFKKRYPGEEIKASELLV*
JGI25910J50241_1000314312F011394N/AMSNFIDKNKNHFKHGINQWTGEPNKPVFYTAEMSKKVRQLKSPASNLQMDIIKYPDFLAIRLYEDNFSQYDGGLKLRVIDYIEMVKNIIESYGVRVELEGKPGGRQQ*
JGI25910J50241_1000314315F040629N/AMEIKAEVEAFNEEDAREYISDIFGIDEEIKSIKVISIQKKS*
JGI25910J50241_100031434F008814N/AMDNKLTVLEEIIKEISEELYQKWYNAPTDVEKTKEWSEIMAKNAGETTFFIIQSFMNKFNAAAEELKDK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.