| Basic Information | |
|---|---|
| Taxon OID | 3300003324 Open in IMG/M |
| Scaffold ID | soilH2_10209668 Open in IMG/M |
| Source Dataset Name | Sugarcane bulk soil Sample H2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1738 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae → unclassified Herpetosiphonaceae → Herpetosiphonaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil → Sugarcane Root And Bulk Soil Microbial Communities From Ayr, Burdekin, Queensland Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ayr, Queensland Australia | |||||||
| Coordinates | Lat. (o) | -19.733298 | Long. (o) | 147.17873 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058524 | Metagenome | 135 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| soilH2_102096682 | F058524 | AGGAGG | MSHIRVLICRVDDPTTDQMTELAAFDLPAADVTALQPDTALDDLETTTHTIGNALLRRVFQAQWDAIDAVLVEQHRQAFSPCDRPRRRA* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |