NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Pfc106_1000033

Scaffold Pfc106_1000033


Overview

Basic Information
Taxon OID3300003254 Open in IMG/M
Scaffold IDPfc106_1000033 Open in IMG/M
Source Dataset NameMarine sponge Petrosia ficiformis associated microbial communities from Achziv, Israel - Sample 106
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)41363
Total Scaffold Genes51 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (41.18%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Sponge Petrosia Ficiformis Associated → Marine Sponge Petrosia Ficiformis Associated Microbial Communities From Achziv, Israel

Source Dataset Sampling Location
Location NameAchziv, Israel
CoordinatesLat. (o)33.01Long. (o)35.04Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055778Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Pfc106_100003321F055778N/AMLSNVDFPEPELPTIKTISPCSTERVALSRALTLFSPSP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.