Basic Information | |
---|---|
Taxon OID | 3300003251 Open in IMG/M |
Scaffold ID | IrcVar142_1001666 Open in IMG/M |
Source Dataset Name | Ircinia variabilis associated microbial communities from Achziv, Israel - Sample 142 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 8179 |
Total Scaffold Genes | 17 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (23.53%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Ircinia Variabilis Associated → Ircinia Variabilis Associated Microbial Communities From Achziv, Israel |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Achziv, Israel | |||||||
Coordinates | Lat. (o) | 33.01 | Long. (o) | 35.04 | Alt. (m) | Depth (m) | 5 to 9 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030805 | Metagenome / Metatranscriptome | 184 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
IrcVar142_100166613 | F030805 | N/A | MEKKIVGAAGTLLLGVSAWLISTVYSIQVDTAIIKDKIEKVYEDNCPYCVHAAHSSIANHPLLGPTIKHSHQHIGREIVKTND* |
⦗Top⦘ |