Basic Information | |
---|---|
Taxon OID | 3300003152 Open in IMG/M |
Scaffold ID | Ga0052254_1090933 Open in IMG/M |
Source Dataset Name | Freshwater sediment microbial communities from Loktak Lake, India |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | National Environmental Engineering Research Institute, India |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 594 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Microbial Communities From Loktak Lake India |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ILoktak Lake, Imphal, India | |||||||
Coordinates | Lat. (o) | 24.562571 | Long. (o) | 93.815303 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F054377 | Metagenome | 140 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0052254_10909331 | F054377 | N/A | AYYSNAIYFIVTPRPYATTPIRAFSIRDGRAMELEIQVLP* |
⦗Top⦘ |