Basic Information | |
---|---|
Taxon OID | 3300003092 Open in IMG/M |
Scaffold ID | Ga0051078_101069 Open in IMG/M |
Source Dataset Name | Hot spring microbial communities from Five Geothermal Springs in Yellowstone National Park, USA - Joseph's Coat Hot Spring-Scorodite Spring |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1226 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Caldivirga → unclassified Caldivirga → Caldivirga sp. MU80 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Five Geothermal Springs In Yellowstone National Park, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Joseph's Coat Hot Spring and Scorodite Spring, Yellowstone National Park, USA | |||||||
Coordinates | Lat. (o) | 44.969421 | Long. (o) | -110.690383 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F105516 | Metagenome | 100 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0051078_1010693 | F105516 | AGG | MPRAIVRVLALGRVSLNLKTFRVTASERLSVDSDGTVNCLGGDCSANGTFITLETEHPNPRELYDALKKVRVLELEVEIHGLPNWLLSRLEFLVGKPTSDKVRYTWHKMPSFGELALVLNDLNLNA* |
⦗Top⦘ |