Scaffold BIH7_10115308

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BIH7_10115308

Scaffold BIH7_10115308

Overview

Basic Information
Taxon OID	3300002922 Open in IMG/M
Scaffold ID	BIH7_10115308 Open in IMG/M
Source Dataset Name	Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_H7
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	738
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Source Dataset Sampling Location
Location Name	Bare Island, Sydney, Australia
Coordinates	Lat. (^o)	-33.59	Long. (^o)	151.13	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047315	Metagenome / Metatranscriptome	150	N

Sequences

Protein ID	Family	RBS	Sequence
BIH7_101153081	F047315	AGG	MSTMTDLEAGKLIAVVEQLDGEIKALRETTAKLTNRVNELDIQLSKGKGFLAGAMLLSMGLGGVGTSFLSKWLGS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.