| Basic Information | |
|---|---|
| Taxon OID | 3300002917 Open in IMG/M |
| Scaffold ID | JGI25616J43925_10004275 Open in IMG/M |
| Source Dataset Name | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6059 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (55.56%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Laytonville, California, USA | |||||||
| Coordinates | Lat. (o) | 39.7392 | Long. (o) | -123.6308 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029163 | Metagenome / Metatranscriptome | 189 | Y |
| F102679 | Metagenome / Metatranscriptome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI25616J43925_100042752 | F029163 | N/A | MRAKISFATARLDDAAGMAEFLSGIPNGEELGKVLQKREAVSSRAYDDETWTARFVDSDGQVVRCFAVSDVTIDQAEMIAAACIDIPALEEAGFREVVAQSLGPTIDAIE* |
| JGI25616J43925_100042755 | F102679 | GAG | MREQTAGGASKAALAVALAFIMFIRPQVSHADNFRRVTYDPVTDELVIVVVYRGTNPDHQFSLKWGPCVDRGGNQHEIVAELLDQQFQDAARKDYKKTVRMSLAAMDCRPAAVTLRTAPRFYYTLTVPARGANGTGP* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |