NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MAL_1004792

Scaffold MAL_1004792


Overview

Basic Information
Taxon OID3300002895 Open in IMG/M
Scaffold IDMAL_1004792 Open in IMG/M
Source Dataset NameMidway enrichment cultures of iron-reducing bacteria from Chocolate Pots hot spring, Yellowstone National Park
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3578
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Iron-Reducing Enrichment Culture → Iron-Reducing Enrichment Culture Microbial Communities From Chocolate Pots Hot Spring, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameUSA: Yellowstone National Park, Wyoming
CoordinatesLat. (o)44.71538Long. (o)-110.73627Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069627Metagenome / Metatranscriptome123Y

Sequences

Protein IDFamilyRBSSequence
MAL_10047922F069627GAGVDLTDEDAVPVYMRISDKVLHLRRLGMTYANIAERLGINPWMPKKAARWAKGQNKQRESFS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.