Basic Information | |
---|---|
Taxon OID | 3300002894 Open in IMG/M |
Scaffold ID | draft_100347 Open in IMG/M |
Source Dataset Name | PDIso1.PF56a |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 8949 |
Total Scaffold Genes | 11 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (90.91%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Tver region, Russia | |||||||
Coordinates | Lat. (o) | 56.56667 | Long. (o) | 32.76667 | Alt. (m) | Depth (m) | .1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F100207 | Metagenome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
draft_1003472 | F100207 | GAG | VRDPLSEIDSNLLPSREEERLLKRALGSAIPEFIARFGAENAIKRAEAELRRARRARSRKLYAFWSAVLAQIDPGRNESSFRGDRTARSPFAPRQGRQPHEGSARLSDDHLSPAPAGGAARPVITGQALEMPAPNAPRKAASRA* |
⦗Top⦘ |