NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold contig_10354

Scaffold contig_10354


Overview

Basic Information
Taxon OID3300002845 Open in IMG/M
Scaffold IDcontig_10354 Open in IMG/M
Source Dataset NameStormwater retention pond microbial communities from Williamsburg, VA - Sample from Crim Dell
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)852
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond → Stormwater Retention Pond Microbial Communities From Williamsburg, Va

Source Dataset Sampling Location
Location NameWilliamsburg, VA
CoordinatesLat. (o)37.270661Long. (o)-76.7142Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034561Metagenome174Y

Sequences

Protein IDFamilyRBSSequence
contig_103542F034561GAGGMLVNWMTTIPGVLTLLSVLFHAWQTKDVNWSDLQNALVALGLVAAKDWNVTGGTKPNN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.