Basic Information | |
---|---|
Taxon OID | 3300002843 Open in IMG/M |
Scaffold ID | contig_10103 Open in IMG/M |
Source Dataset Name | Stormwater retention pond microbial communities from Williamsburg, VA - Sample from Greensprings |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1858 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond → Stormwater Retention Pond Microbial Communities From Williamsburg, Va |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Jamestown, Virginia, United States | |||||||
Coordinates | Lat. (o) | 37.248966 | Long. (o) | -76.787831 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F086796 | Metagenome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
contig_101031 | F086796 | N/A | MIDYCEPYLKIQKLVKAYHNATLKQNYEKATKIAHELADETIRLEIASIKQLKNQWVKQ* |
⦗Top⦘ |