| Basic Information | |
|---|---|
| Taxon OID | 3300002843 Open in IMG/M |
| Scaffold ID | contig_10013 Open in IMG/M |
| Source Dataset Name | Stormwater retention pond microbial communities from Williamsburg, VA - Sample from Greensprings |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8555 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond → Stormwater Retention Pond Microbial Communities From Williamsburg, Va |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Jamestown, Virginia, United States | |||||||
| Coordinates | Lat. (o) | 37.248966 | Long. (o) | -76.787831 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037693 | Metagenome | 167 | Y |
| F042791 | Metagenome | 157 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| contig_100133 | F042791 | N/A | MFSTAFQANAFQNNAFQVYNPPPPDNNRVGGDDAWYTQEELRRIQKLHQKIAARQRLLEKATKDANAARKQAIRDLVSPVAKVKQPKVQSTQEVKADIPLAETEELQRSISYLERQRDNILQAVAYRQEYARIQANLRILEAKRLEELDDEESVLILLH* |
| contig_100135 | F037693 | AGGAG | MALVKKVVTCVHCKVDHEEYDETQFNDREKYLAYWNLPFEGPEADAAWAEKENMTFRPAPTVIPDIEGHISMADGTWVDSRSKHRENLKRNNCIELGNDVPTQQKKHELSRSEREHLKRTLAEVTYAKLR* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |