NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J40625_100073761

Scaffold B570J40625_100073761


Overview

Basic Information
Taxon OID3300002835 Open in IMG/M
Scaffold IDB570J40625_100073761 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4492
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.099444Long. (o)-89.404444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044319Metagenome / Metatranscriptome154N
F076899Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
B570J40625_1000737611F044319N/AMKIVDLIASQAGLARFASFTYCSKSTGEVARYTLQLGFSYRNILQKSIMELEVDRQIMADLPRQAADEILASLNASLSGTQTKYTKKDIYEDYKVDGKTVQGIKVNKNDGSLKIFGLVTSKVQITPPVAPYKETKSAPLTIEKNRITKTLPIGRFREFAL
B570J40625_1000737613F076899N/AMNFSNVNTGTVISGKQGYDIAITAAINSFTANGVNIPVSTTNQLYLSNAPLLVTGNVTNATAGTIFYYYQGNVKGQD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.