Basic Information | |
---|---|
Taxon OID | 3300002702 Open in IMG/M |
Scaffold ID | draft_10479821 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Biofilm from sections of failed pipe of Encana Pipeline |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 30898 |
Total Scaffold Genes | 38 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 35 (92.11%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Fort McMurray, Alberta, Canda | |||||||
Coordinates | Lat. (o) | 55.07 | Long. (o) | -110.53 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025668 | Metagenome | 200 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
draft_1047982122 | F025668 | GGAGG | MIKLSIIEAQDYLRVKTEDGYKRIVDIHSLLKSHSINEVVLFLKDYLREKENSLRNMILIDKTHCKVDQIVASMFRITMAIKALKEGEEVISLEESQQRAETRRTIHKRNSRGHRSSWKRENKNHDGKNRVSGNPAKRAA* |
⦗Top⦘ |