NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold draft_10479190

Scaffold draft_10479190


Overview

Basic Information
Taxon OID3300002702 Open in IMG/M
Scaffold IDdraft_10479190 Open in IMG/M
Source Dataset NameWastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Biofilm from sections of failed pipe of Encana Pipeline
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12132
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (71.43%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameFort McMurray, Alberta, Canda
CoordinatesLat. (o)55.07Long. (o)-110.53Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048134Metagenome / Metatranscriptome148Y

Sequences

Protein IDFamilyRBSSequence
draft_1047919012F048134AGGAGGMESSNNVQINLSIPEQYRNLLRRMAAERVMCDPSQVVTGASIATDLLLTALRKLAGEKNEGGNKS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.