NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24135J36437_1000911

Scaffold JGI24135J36437_1000911


Overview

Basic Information
Taxon OID3300002551 Open in IMG/M
Scaffold IDJGI24135J36437_1000911 Open in IMG/M
Source Dataset NameArctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7900
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (30.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Saccharicrinis → Saccharicrinis carchari(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameBarrow, Alaska, USA
CoordinatesLat. (o)71.290565Long. (o)-156.788622Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007838Metagenome / Metatranscriptome344Y
F021450Metagenome219N

Sequences

Protein IDFamilyRBSSequence
JGI24135J36437_10009111F021450N/ATISLLALLLLFSIEIQAQVTNVLNNFYTVWVKPAIPIIGGLVLIVGALANIGKVLGDSRDYRGFITSIVLYLAVYFCLVGIAAFIMAG*
JGI24135J36437_10009114F007838N/AMRTLFTFLLLLLTYEIFGQVPAGLTMVVKNPAWQAEDAAKESLEKADRIRQITTLTEQVNTQKESLQTIRDATEKLRKINRKVANYHNLELAIVQVSDSYTRVLGSLKTISDHNCFKPSEYHMISESMMGLLSQTSYAITTLTVVLTDNFSEMSDGERLLNMNQAIKELRENLGVINSAIIEVEILDNQRMQLRTLNYINSIFK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.