NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LO132_10063187

Scaffold LO132_10063187


Overview

Basic Information
Taxon OID3300002465 Open in IMG/M
Scaffold IDLO132_10063187 Open in IMG/M
Source Dataset NameAnoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterPennsylvania State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1441
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake → Freshwater Lake Biofilm Microbial Communities From Frasassi Caves, Italy In Anoxic Conditions

Source Dataset Sampling Location
Location NameFrasassi Caves, Italy
CoordinatesLat. (o)43.3833Long. (o)12.95Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056343Metagenome / Metatranscriptome137N

Sequences

Protein IDFamilyRBSSequence
LO132_100631872F056343AGGAGMPEPITDSQVLSSYLAEEQINGFTVKPWTIKQLLLVMPILDALVQEFKTQGVTLDNLGEVFEGQGLAAAKDIIQTILPRLPEFLSVTLRIDLEQAEEIDLGLGLQLAVKVLRMNVDHLKNAFGLIMSQVGVLIGPEATS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.