NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold KVWGV2_10364880

Scaffold KVWGV2_10364880


Overview

Basic Information
Taxon OID3300002242 Open in IMG/M
Scaffold IDKVWGV2_10364880 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1167
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Hellenic Volcanic Arc

Source Dataset Sampling Location
Location NameKolumbo Volcano, Greece
CoordinatesLat. (o)36.5Long. (o)25.45Alt. (m)Depth (m)494
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021208Metagenome220Y

Sequences

Protein IDFamilyRBSSequence
KVWGV2_103648804F021208GAGGMFRXIRPNXLDKINRLQSMKKLPIGAMGERDSRINKLINKLYNRKEDYDRSN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.