Basic Information | |
---|---|
Taxon OID | 3300002242 Open in IMG/M |
Scaffold ID | KVWGV2_10293884 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1024 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Hellenic Volcanic Arc |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kolumbo Volcano, Greece | |||||||
Coordinates | Lat. (o) | 36.5 | Long. (o) | 25.45 | Alt. (m) | Depth (m) | 494 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011841 | Metagenome | 286 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
KVWGV2_102938843 | F011841 | GAG | MNYTEILKIWNSETPDDFAIFSEFYYQMFGEDYDIPYTTDSTRSAFFPFD* |
⦗Top⦘ |