NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24793J26633_1026591

Scaffold JGI24793J26633_1026591


Overview

Basic Information
Taxon OID3300002147 Open in IMG/M
Scaffold IDJGI24793J26633_1026591 Open in IMG/M
Source Dataset NameHost-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by freeze-thaw cycling
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1229
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea

Source Dataset Sampling Location
Location NameGulf of Piran, Adriatic Sea
CoordinatesLat. (o)45.5099Long. (o)13.56Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096818Metagenome104Y

Sequences

Protein IDFamilyRBSSequence
JGI24793J26633_10265912F096818N/AANRTTYPQGWPPFGATDSRSWGPSRTIYWSKVLFEKWWLWRYF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.