Basic Information | |
---|---|
Taxon OID | 3300002095 Open in IMG/M |
Scaffold ID | C687J26659_1003241 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection C3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1994 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Soil Microbial Communities From Rifle, Colorado, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rifle, Colorado, USA | |||||||
Coordinates | Lat. (o) | 39.534762 | Long. (o) | -107.782602 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050966 | Metagenome / Metatranscriptome | 144 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
C687J26659_10032411 | F050966 | GAGG | MSGSMWQGMKTRHGDGTEALSEEMESNGSATPKSRRHP |
⦗Top⦘ |