| Basic Information | |
|---|---|
| Taxon OID | 3300001983 Open in IMG/M |
| Scaffold ID | plot12_101557 Open in IMG/M |
| Source Dataset Name | Switchgrass rhizosphere and bulk soil microbial communities from Knoxville, Tennessee, USA - plot1-2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 538 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Clay → Grasslands → Switchgrass Rhizosphere And Bulk Soil → Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Knoxville, Tennessee, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Knoxville, Tennessee, USA | |||||||
| Coordinates | Lat. (o) | 35.9728 | Long. (o) | -83.9422 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033179 | Metagenome / Metatranscriptome | 178 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| plot12_1015571 | F033179 | N/A | LDRSSAASDVYKRQQHIACGERVTTTHAEIVQAARNLHDQIRHAGFRQAQDIFDNPTPFHPGNDVFYDHACTGDEVIEEPVCYAQLLAFGVFLAAA* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |