NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2224_1049248

Scaffold GOS2224_1049248


Overview

Basic Information
Taxon OID3300001952 Open in IMG/M
Scaffold IDGOS2224_1049248 Open in IMG/M
Source Dataset NameMarine microbial communities from Newport Harbor, Rhode Island, USA - GS008
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1526
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameNewport Harbor, Rhode Island, USA
CoordinatesLat. (o)41.485832Long. (o)-71.35111Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059370Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
GOS2224_10492481F059370N/AMINVYCVNVGTKYNRDFDQRLKDSVAKHLTLDHKFTCLTDKPEKEYDVPVTHPQLRGVFHKLSLFQYTGKCLFFDLDIEINDNIDFLAHEFDQLTLVNSSPWKQQSLKQPLKFRITQNTLINSSIMRWSDERKVFEKFIEHRDLYVRLYSGIDRFIYNEDVKYKYFMGDEISSWQEGVKHNTILLHNQKYV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.