Basic Information | |
---|---|
Taxon OID | 3300001938 Open in IMG/M |
Scaffold ID | GOS2221_1022997 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1682 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bedford Basin, Nova Scotia, Canada | |||||||
Coordinates | Lat. (o) | 44.690277 | Long. (o) | -63.637222 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067744 | Metagenome | 125 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2221_10229971 | F067744 | N/A | EITEAQLRGDFSPDDKLKYLLGELSEIEKGMTWTDLHITDNFFFGFDKKDYIDPWRGISYHDYVKDVSHGDYKFFIASHFNPEVIEIKKIWKNANIILFTHPHDYVEKRASKDPNIKVFYERLCDYEENIEEMRALPNVVYEFDVRKYESETETLDAVKEMYDLLGIRGYDREKLSIYYNDWYNKIEEIKL* |
⦗Top⦘ |