NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2220_1002192

Scaffold GOS2220_1002192


Overview

Basic Information
Taxon OID3300001936 Open in IMG/M
Scaffold IDGOS2220_1002192 Open in IMG/M
Source Dataset NameMarine microbial communities from Halifax, Nova Scotia, Canada - GS004
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1294
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameHalifax, Nova Scotia, Canada
CoordinatesLat. (o)44.137222Long. (o)-63.644444Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038691Metagenome / Metatranscriptome165Y
F066809Metagenome / Metatranscriptome126Y
F067751Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
GOS2220_10021921F066809N/AMVTSMKGKGFFEARNFIELMAAFGQDLSEVVQKVHKDNQALRDNHVRLSELDTEVNHPDVILDVAIDKYNEAEQELTDLMNEVDPVVETV*
GOS2220_10021922F038691AGTAGMGFHRRHIDNDQVIRLYESGGLIKIKEWYTRGVDALVTETGLASQVGSILSDDDWVIMGTAVQEKEIIKLIQKHLGIVDSKK*
GOS2220_10021923F067751N/AMEHIKGYKLFKESLDTELLTERFSSDILRQFTAQDGGSRWRGGIAKDMQKFASLALDKISDADFTTTTPEAYWKGGDAKNPNKVGFFVDDDPGFIEWAKANKKYMPGNLSLGNISKYGVVLSVIRGGIGMYHGFSMDRGSTYSRHRKGTEERYGLLAKEYETRSMYNGWDGAPAAKVTRKNLIDAATRVYVLDLDSLRDKYDVSGLKSDRAISKMGAVALKSAKDIKKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.