NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold RCM26_1117554

Scaffold RCM26_1117554


Overview

Basic Information
Taxon OID3300001849 Open in IMG/M
Scaffold IDRCM26_1117554 Open in IMG/M
Source Dataset NameMarine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)915
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location NameAfu?, Para, Brazil
CoordinatesLat. (o)-0.083883Long. (o)-51.051417Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001299Metagenome / Metatranscriptome727Y

Sequences

Protein IDFamilyRBSSequence
RCM26_11175542F001299GAGMNDNFNPDYLDDTDPEKNYDYYRQDHGGTITNHNGVADKLLKNNDLYRSMKGDWQRTSTNQSGNIIVTTGREDGKFFIKREQQNAKAIAAHCAEYRKTAEAGYLDPLAPIGEDGKLQYKWMELPKVVAIRISDQYFGGIPWAVIKNDRTLKAQFYRVVEQEYPQYVCYPGGKLPIPVDVPYPTKAGEKKFFKGH*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.